Mycobacteroides salmoniphilum: DSM43276_01962 Help Entry DSM43276_01962    CDS       T06041                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism msal  Mycobacteroides salmoniphilum Pathway msal00261   Monobactam biosynthesis msal01100   Metabolic pathways msal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DSM43276_01962  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msal01008]     DSM43276_01962 Polyketide biosynthesis proteins [BR:msal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DSM43276_01962 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH UvsW-1 Motif Other DBs NCBI-ProteinID:  QCH23702 LinkDB All DBs Position 1999297..1999527 Genome browser AA seq 76 aa AA seqDB search MKGKQLSTNPFDDENGAFYVLVNDEEQHSLWPTAIEVPAQWRVAFGEASRADCVEYVEAN WTDMRPKSLRDAMAGK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgaaaggaaaacaattgagtaccaacccatttgatgacgagaatggtgccttctacgta ctggtcaacgacgaggagcagcacagtctgtggccgacggccattgaggttccggcgcaa tggcgcgtggcctttggggaggcctcgcgtgccgactgtgtggagtacgtcgaagccaat tggaccgatatgcggcccaagagcctgcgtgacgcgatggcaggcaagtag

DBGET integrated database retrieval system