Mycolicibacterium sarraceniae: MSAR_19690 Help Entry MSAR_19690        CDS       T07083                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism msar  Mycolicibacterium sarraceniae Pathway msar00261   Monobactam biosynthesis msar01100   Metabolic pathways msar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msar00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MSAR_19690  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msar01008]     MSAR_19690 Polyketide biosynthesis proteins [BR:msar01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MSAR_19690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBY58833 UniProt:  A0A7I7SQ06 LinkDB All DBs Position 1948632..1948829 Genome browser AA seq 65 aa AA seqDB search MNTNPFDAEDGRFYVLVNDEDQYSLWPAFAEVPAGWRLVFGDASRSDCVQFVERNWSDMR PRSLR NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgaacaccaatccctttgacgccgaggacggccgcttctatgtcctcgtcaacgacgag gaccagtacagcctgtggccggcgttcgccgaggtcccggcgggctggcggctggtgttc ggcgacgcgagccggagcgactgcgtgcagttcgtcgaacgcaactggtctgacatgcgc ccgcggagcttgcgctga

DBGET integrated database retrieval system