Mucispirillum schaedleri: N508_001432 Help Entry N508_001432       CDS       T08201                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism msch  Mucispirillum schaedleri Pathway msch00020   Citrate cycle (TCA cycle) msch01100   Metabolic pathways msch01110   Biosynthesis of secondary metabolites msch01120   Microbial metabolism in diverse environments msch01200   Carbon metabolism msch01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:msch00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     N508_001432 Enzymes [BR:msch01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      N508_001432 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_7 Fer4_2 Fer4_10 Fer4_6 Fer4_21 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_15 Fer4_3 Motif Other DBs NCBI-ProteinID:  USF24346 UniProt:  V2QB80 LinkDB All DBs Position complement(1505120..1505311) Genome browser AA seq 63 aa AA seqDB search MAKSEIKIYKERCKGCEICVVLCPAQVLDMQDFKVHIADIEKCTACMQCELRCPDFAIEV TRL NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaagtgaaataaaaatatataaagaaaggtgcaaaggctgcgaaatatgcgtt gtgctttgtcctgcacaggtgcttgatatgcaggattttaaagtgcatattgcagatata gaaaaatgcacagcatgtatgcagtgtgagttaagatgtcctgattttgcaatagaagtt acgaggttatag

DBGET integrated database retrieval system