Mesoterricola sediminis: METESE_17430 Help Entry METESE_17430      CDS       T09356                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism msea  Mesoterricola sediminis Pathway msea00020   Citrate cycle (TCA cycle) msea01100   Metabolic pathways msea01110   Biosynthesis of secondary metabolites msea01120   Microbial metabolism in diverse environments msea01200   Carbon metabolism msea01210   2-Oxocarboxylic acid metabolism Module msea_M00009   Citrate cycle (TCA cycle, Krebs cycle) msea_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:msea00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     METESE_17430 Enzymes [BR:msea01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      METESE_17430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_10 Fer4_16 Fer4_2 Fer4_9 Fer4_6 Fer4_4 Fer4_17 Fer4_13 Fer4_8 Fer4_3 Motif Other DBs NCBI-ProteinID:  BDU76785 UniProt:  A0AA48GYK5 LinkDB All DBs Position complement(2021006..2021272) Genome browser AA seq 88 aa AA seqDB search MSEGQERKGRGTVWVKQEVCKGCSYCIDFCPTHALQFSREFNAKGYHFPVLERPEDCTGC DNCGLYCPDFAIYGARWKDIDAKKAQNA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaggacaggaacgaaaaggccggggcaccgtgtgggtgaagcaggaggtctgc aaaggctgctcctactgcatcgacttctgccccacccacgccctgcagttctcgcgcgaa ttcaacgcgaagggctaccacttcccggtcctcgagcgtcccgaggactgcacgggctgc gacaactgcggcctctactgcccggacttcgcgatctacggagcccggtggaaggacatc gacgcgaagaaggcgcagaacgcgtaa

DBGET integrated database retrieval system