Mycolicibacterium sediminis: MSEDJ_48160 Help Entry MSEDJ_48160       CDS       T07629                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism msei  Mycolicibacterium sediminis Pathway msei00261   Monobactam biosynthesis msei01100   Metabolic pathways msei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msei00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MSEDJ_48160 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msei01008]     MSEDJ_48160 (mbtH) Polyketide biosynthesis proteins [BR:msei01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MSEDJ_48160 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBY30720 UniProt:  A0A7I7QXZ6 LinkDB All DBs Position complement(4987253..4987468) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDENGTFVVLVNDEEQHSLWPTFADVPAGWRTVFGEGTRADCLAYVEENWTDLR PKSLRDAMSAD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccgttcgatgacgagaacggcaccttcgtggtgctggtgaacgacgag gagcagcacagcctgtggccgacgtttgccgacgtccccgccggctggcggaccgtgttc ggggagggcacccgggccgactgcctcgcctacgtcgaggagaactggaccgacctgcgc ccgaagtccttgcgcgacgccatgtccgcggactga

DBGET integrated database retrieval system