Mycolicibacterium senegalense: K3U95_16600 Help Entry K3U95_16600       CDS       T07649                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism msen  Mycolicibacterium senegalense Pathway msen00261   Monobactam biosynthesis msen01100   Metabolic pathways msen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msen00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     K3U95_16600  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msen01008]     K3U95_16600 Polyketide biosynthesis proteins [BR:msen01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     K3U95_16600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QZA22380 LinkDB All DBs Position complement(3526546..3526764) Genome browser AA seq 72 aa AA seqDB search MSTNPFDDENGMFHVLVNDEGQHSLWPAFADVPAGWQVVFGTAGRAECLDYVEANWTDLR PASLREAMSSST NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagtaccaatccgttcgatgacgagaacggcatgttccatgtcctggtcaacgacgag ggccagcacagcctgtggcccgcgttcgccgatgtgcctgccggttggcaggtggtcttc ggtacggccggccgggctgagtgcctggactacgtggaggccaactggacggacctgcgg cccgcgagcctgcgcgaggcgatgagtagcagcacctga

DBGET integrated database retrieval system