Mycolicibacterium smegmatis MC2 155: MSMEI_0018 Help Entry MSMEI_0018        CDS       T02191                                  Symbol mbtH Name (GenBank) MbtH like protein   KO K05375   MbtH protein Organism msg  Mycolicibacterium smegmatis MC2 155 Pathway msg00261   Monobactam biosynthesis msg01100   Metabolic pathways msg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MSMEI_0018 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msg01008]     MSMEI_0018 (mbtH) Polyketide biosynthesis proteins [BR:msg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MSMEI_0018 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFP36501 UniProt:  I7G130 LinkDB All DBs Position 16896..17132 Genome browser AA seq 78 aa AA seqDB search MSTNPFDDTDGRFVVLVNDEGQHSLWPVFAGVPAGWTVAFGGAGGADRGSALRFVDENWN DLRPRSLREATDNTATLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt ttgtccaccaatccttttgacgacaccgacggccgcttcgtggtcctggtcaacgacgag ggccaacattcgctgtggcccgtgttcgccggcgttcccgcaggctggacggtcgcgttc ggcggcgccggcggcgctgatcgtggcagtgccctgcgctttgtcgacgagaactggaac gatctgcgtccgcggtcgctgcgcgaagccaccgacaatacggccactttggcgtga

DBGET integrated database retrieval system