Mycolicibacterium smegmatis INHR2: LI98_22310 Help Entry LI98_22310        CDS       T03432                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism msh  Mycolicibacterium smegmatis INHR2 Pathway msh00261   Monobactam biosynthesis msh01100   Metabolic pathways msh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LI98_22310  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msh01008]     LI98_22310 Polyketide biosynthesis proteins [BR:msh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LI98_22310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIU22828 UniProt:  A0A8B4R3E7 LinkDB All DBs Position complement(4583879..4584088) Genome browser AA seq 69 aa AA seqDB search MSTNPFDDDNGTFYVLVNDEDQHSLWPAFADVPTGWRVVFGAGTRAECLDYVEANWTDLR PRTLREAVR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccgttcgatgacgacaacggcaccttctacgtgctggtgaacgacgag gaccagcacagcctgtggccggcgttcgccgatgtgcccacgggctggcgtgtggtgttc ggtgcgggcacccgcgccgagtgcctggattacgtcgaggcgaactggaccgacctgcgg ccgaggacgctgcgcgaggccgttcgatag

DBGET integrated database retrieval system