Mycobacterium shigaense: MSG_02412 Help Entry MSG_02412         CDS       T05717                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism mshg  Mycobacterium shigaense Pathway mshg00261   Monobactam biosynthesis mshg01100   Metabolic pathways mshg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mshg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MSG_02412 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mshg01008]     MSG_02412 (mbtH) Polyketide biosynthesis proteins [BR:mshg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MSG_02412 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  BAX92556 UniProt:  A0A1Z4EI13 LinkDB All DBs Position 2571485..2571694 Genome browser AA seq 69 aa AA seqDB search MQTNPFDDDRGDFYVLVNHEDQHSLWPRFADLPAGWNVIYGKADRAACLDYVESNWTDMR SRSLREKSA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcagaccaatccgttcgacgacgaccgcggcgacttctacgtcctggtcaaccacgaa gaccagcacagcctgtggccgcgcttcgccgacctgccggccggctggaacgtgatttac ggaaaagccgatcgcgcagcgtgtctggactatgtcgaaagcaattggactgatatgcgg tcgaggagtctgcgcgagaaatcggcctag

DBGET integrated database retrieval system