Mycobacterium shinjukuense: MSHI_08240 Help Entry MSHI_08240        CDS       T07415                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mshj  Mycobacterium shinjukuense Pathway mshj00261   Monobactam biosynthesis mshj01100   Metabolic pathways mshj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mshj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MSHI_08240  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mshj01008]     MSHI_08240 Polyketide biosynthesis proteins [BR:mshj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MSHI_08240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF359 Motif Other DBs NCBI-ProteinID:  BBX72918 UniProt:  A0A7I7ML13 LinkDB All DBs Position 945652..945867 Genome browser AA seq 71 aa AA seqDB search MSTNPFDDEAGTFYVLVNGEEQHSLWPAFADVPAGWRVVFGADSRANCLAYVEENWTDIR PRSLREAMARE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagtaccaatccgtttgacgatgaggccggtacattctacgtgctggtcaacggcgag gaacagcacagcctgtggccggcgttcgccgacgtgccggcgggttggcgggtggtgttc ggcgccgatagccgggcgaattgccttgcctacgtggaggagaactggaccgatatccgc cccaggagcttgcgcgaggcgatggcccgcgagtag

DBGET integrated database retrieval system