Mycolicibacterium smegmatis MC2 155: MSMEG_0016 Help Entry MSMEG_0016        CDS       T00434                                  Name (GenBank) conserved domain protein   KO K05375   MbtH protein Organism msm  Mycolicibacterium smegmatis MC2 155 Pathway msm00261   Monobactam biosynthesis msm01100   Metabolic pathways msm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:msm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MSMEG_0016  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:msm01008]     MSMEG_0016 Polyketide biosynthesis proteins [BR:msm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MSMEG_0016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABK71911 UniProt:  A0QNE8 LinkDB All DBs Position 15256..15522 Genome browser AA seq 88 aa AA seqDB search MAENLGGRKRLSTNPFDDTDGRFVVLVNDEGQHSLWPVFAGVPAGWTVAFGGAGGADRGS ALRFVDENWNDLRPRSLREATDNTATLA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gtggccgaaaatctcgggggaaggaaacgtttgtccaccaatccttttgacgacaccgac ggccgcttcgtggtcctggtcaacgacgagggccaacattcgctgtggcccgtgttcgcc ggcgttcccgcaggctggacggtcgcgttcggcggcgccggcggcgctgatcgtggcagt gccctgcgctttgtcgacgagaactggaacgatctgcgtccgcggtcgctgcgcgaagcc accgacaatacggccactttggcgtga

DBGET integrated database retrieval system