Methanosphaera stadtmanae: Msp_0335 Help Entry Msp_0335          CDS       T00313                                  Symbol porD Name (GenBank) PorD   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mst  Methanosphaera stadtmanae Pathway mst00010   Glycolysis / Gluconeogenesis mst00020   Citrate cycle (TCA cycle) mst00620   Pyruvate metabolism mst00640   Propanoate metabolism mst00650   Butanoate metabolism mst00680   Methane metabolism mst00720   Carbon fixation pathways in prokaryotes mst01100   Metabolic pathways mst01110   Biosynthesis of secondary metabolites mst01120   Microbial metabolism in diverse environments mst01200   Carbon metabolism mst01210   2-Oxocarboxylic acid metabolism Module mst_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA mst_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mst00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     Msp_0335 (porD)    00020 Citrate cycle (TCA cycle)     Msp_0335 (porD)    00620 Pyruvate metabolism     Msp_0335 (porD)    00640 Propanoate metabolism     Msp_0335 (porD)    00650 Butanoate metabolism     Msp_0335 (porD)   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     Msp_0335 (porD)    00680 Methane metabolism     Msp_0335 (porD)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     Msp_0335 (porD) Enzymes [BR:mst01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      Msp_0335 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_2 Fer4_9 Fer4_10 Fer4_4 Fer4_16 Fer4_17 Fer4_8 Fer4_3 Fer4_13 Fer4_15 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  ABC56745 UniProt:  Q2NHX1 LinkDB All DBs Position 396863..397105 Genome browser AA seq 80 aa AA seqDB search MVAKGAVVKEPGSTRKNKTGSWRTFKPVADKDKCISCGLCYLFCPDGCISVEFNHDYDYC KGCGICAEECPVDAIKMVRE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtagcaaaaggagcagttgttaaagaacctggaagtactagaaaaaataaaactggt agttggaggacatttaaacctgttgcagataaagataaatgtataagctgtggtctttgt tatttattctgtccagatggttgtatttcagtagaatttaatcatgattatgactattgt aaaggttgtggaatatgtgcagaggaatgtccagttgacgcaattaaaatggtgagggaa taa

DBGET integrated database retrieval system