Methanosphaera stadtmanae: Msp_1390 Help Entry Msp_1390          CDS       T00313                                  Symbol korD Name (GenBank) KorD   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mst  Methanosphaera stadtmanae Pathway mst00020   Citrate cycle (TCA cycle) mst00720   Carbon fixation pathways in prokaryotes mst01100   Metabolic pathways mst01110   Biosynthesis of secondary metabolites mst01120   Microbial metabolism in diverse environments mst01200   Carbon metabolism mst01210   2-Oxocarboxylic acid metabolism Module mst_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mst00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Msp_1390 (korD)   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     Msp_1390 (korD) Enzymes [BR:mst01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Msp_1390 (korD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_13 Fer4_15 Fer4_8 Fer4_3 Fer4_17 ETF_QO Fer4_18 Motif Other DBs NCBI-ProteinID:  ABC57762 UniProt:  Q2NEJ1 LinkDB All DBs Position complement(1559595..1559795) Genome browser AA seq 66 aa AA seqDB search MLYINEELCKGCYICVDICPMDVYTPSETLNHKGVHIPIPDNEKCIKCNLCALMCPDQVI SIEDDD NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgttatacataaatgaagaattgtgtaaaggatgctatatttgtgttgacatttgtcca atggatgtgtataccccatctgaaacactaaatcataaaggtgtacatatacctattcca gacaatgaaaaatgcataaaatgtaacttatgtgcattaatgtgtcctgatcaagtaatt tcaatagaggatgatgattaa

DBGET integrated database retrieval system