Methanoculleus submarinus: OH143_10940 Help Entry OH143_10940       CDS       T08553                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism msum  Methanoculleus submarinus Pathway msum00020   Citrate cycle (TCA cycle) msum00720   Carbon fixation pathways in prokaryotes msum01100   Metabolic pathways msum01110   Biosynthesis of secondary metabolites msum01120   Microbial metabolism in diverse environments msum01200   Carbon metabolism msum01210   2-Oxocarboxylic acid metabolism Module msum_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:msum00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     OH143_10940   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     OH143_10940 Enzymes [BR:msum01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      OH143_10940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_16 Fer4_4 Fer4_9 Fer4_15 Fer4_3 Fer4_13 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  UYU18208 LinkDB All DBs Position complement(2142298..2142570) Genome browser AA seq 90 aa AA seqDB search MKLVIDESRCKGCNLCVLVCPYGIFREGTELNSRGIVTPILDRPERCTNCRLQALYGRML CGVCHMICPDQAISWVEEKPFEPHRVEVEF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaactcgtcatcgatgaaagccgctgcaaaggatgcaacctctgcgtgctggtctgc ccctacggtatatttcgggagggaacggaactcaacagccgggggatcgtcacccccatc ctcgaccgccccgaacggtgtacgaactgcaggctgcaggccctctacggcaggatgctc tgcggggtctgccacatgatctgccctgaccaggccatctcctgggtcgaggagaagccg ttcgagcctcaccgggtggaggtggagttttga

DBGET integrated database retrieval system