Mesobacillus subterraneus: LC048_16360 Help Entry LC048_16360       CDS       T09285                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism msut  Mesobacillus subterraneus Pathway msut00020   Citrate cycle (TCA cycle) msut01100   Metabolic pathways msut01110   Biosynthesis of secondary metabolites msut01120   Microbial metabolism in diverse environments msut01200   Carbon metabolism msut01210   2-Oxocarboxylic acid metabolism Module msut_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:msut00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LC048_16360 Enzymes [BR:msut01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LC048_16360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_21 Fer4_6 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_8 Fer4_3 Fer4_17 Fer4_18 Fer4_22 DJ-1_PfpI ETF_QO Motif Other DBs NCBI-ProteinID:  WLR54055 LinkDB All DBs Position complement(3150285..3150515) Genome browser AA seq 76 aa AA seqDB search MEQRVVFNEETCKSCKLCVNACPTNVIYLADYLNEKGYRPAVVTDQENCISCGKCAQMCP DSVITVYRPEKVRKSV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtggagcagagagttgtttttaatgaagagacttgtaaatcatgcaagctgtgcgtgaac gcttgtccgacaaatgtcatttatcttgctgattacttgaatgaaaaaggctaccggccg gcggttgtgacagaccaggaaaattgcatcagctgtggcaagtgcgcgcaaatgtgtccg gattcggtgatcactgtttataggccagaaaaggtaaggaaatctgtatag

DBGET integrated database retrieval system