Methanothermobacter tenebrarum: MTTB_03900 Help Entry MTTB_03900        CDS       T08102                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mtee  Methanothermobacter tenebrarum Pathway mtee00020   Citrate cycle (TCA cycle) mtee00720   Carbon fixation pathways in prokaryotes mtee01100   Metabolic pathways mtee01110   Biosynthesis of secondary metabolites mtee01120   Microbial metabolism in diverse environments mtee01200   Carbon metabolism mtee01210   2-Oxocarboxylic acid metabolism Module mtee_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mtee00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MTTB_03900   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MTTB_03900 Enzymes [BR:mtee01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MTTB_03900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_16 Fer4_9 Fer4_4 Fer4_21 Fer4_15 Fer4_13 Fer4_8 Fer4_22 Fer4_3 Motif Other DBs NCBI-ProteinID:  BDH79011 LinkDB All DBs Position complement(365931..366134) Genome browser AA seq 67 aa AA seqDB search MIRIDPELCKGCNICIEFCPEKVYEESDTLNKRGVYVPVPEHEDRCKKCKICILFCPDQA IAVDENG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgatacgtatagatcctgaactttgcaaaggatgtaacatatgcatagagttttgcccc gagaaagtctatgaagaatctgatacattaaataaaaggggagtttacgtcccagtacct gaacatgaggataggtgtaaaaaatgcaagatctgtattttattctgcccagatcaagcc atagcggtggatgaaaatggttga

DBGET integrated database retrieval system