Microbulbifer thermotolerans: A3224_14715 Help Entry A3224_14715       CDS       T04393                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism mthd  Microbulbifer thermotolerans Pathway mthd00261   Monobactam biosynthesis mthd01100   Metabolic pathways mthd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mthd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A3224_14715  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mthd01008]     A3224_14715 Polyketide biosynthesis proteins [BR:mthd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A3224_14715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AMX03669 UniProt:  A0A143HPM6 LinkDB All DBs Position complement(3573616..3573849) Genome browser AA seq 77 aa AA seqDB search MREDEYNNPFDSEDKDFLVLKNAYGQYSLWPDFMAIPTGWESVYGPEARRACDEFIEAHW QAINPFSVSGKQPEAQS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagagaagacgagtataacaatccattcgacagcgaggataaggatttcctggtgctt aagaatgcatacgggcaatacagcttatggccagacttcatggcgatacccacgggctgg gagtctgtgtatgggccggaagctcgccgggcctgcgatgaatttatcgaagcgcattgg caggccataaatcctttttctgtctccggtaaacaaccggaggcgcaatcatga

DBGET integrated database retrieval system