Methanothermobacter sp. THM-1: FZP57_06780 Help Entry FZP57_06780       CDS       T06420                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mthm  Methanothermobacter sp. THM-1 Pathway mthm00020   Citrate cycle (TCA cycle) mthm00720   Carbon fixation pathways in prokaryotes mthm01100   Metabolic pathways mthm01110   Biosynthesis of secondary metabolites mthm01120   Microbial metabolism in diverse environments mthm01200   Carbon metabolism mthm01210   2-Oxocarboxylic acid metabolism Module mthm_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mthm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FZP57_06780   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     FZP57_06780 Enzymes [BR:mthm01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FZP57_06780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_21 Fer4_2 Fer4_6 Fer4_7 Fer4_9 Fer4_4 Fer4_16 Fer4_13 Fer4_8 Fer4_3 Fer4_17 Fer4_15 ETF_QO Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  QHN06770 UniProt:  A0A6B9TFR8 LinkDB All DBs Position 1317855..1318064 Genome browser AA seq 69 aa AA seqDB search MTMIKIDSDLCKGCDICREFCPEGVYVRSEELNRKGVHEPVPENLEKCTGCKLCMLLCPD QAIVVYEDD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccatgataaagatagattcagatctctgtaagggatgtgacatatgcagagagttc tgccccgaaggggtctatgttagatcagaggaactcaacaggaagggtgtgcatgagcca gtcccggaaaatctggaaaaatgcacgggatgcaagctctgcatgctcctgtgtccagat caggcgatagtggtgtatgaagatgactga

DBGET integrated database retrieval system