Mycolicibacterium thermoresistibile: 4412656_02804 Help Entry 4412656_02804     CDS       T05542                                  Symbol mbtH_1 Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism mthn  Mycolicibacterium thermoresistibile Pathway mthn00261   Monobactam biosynthesis mthn01100   Metabolic pathways mthn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mthn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     4412656_02804 (mbtH_1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mthn01008]     4412656_02804 (mbtH_1) Polyketide biosynthesis proteins [BR:mthn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     4412656_02804 (mbtH_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  SNW18973 LinkDB All DBs Position 1:complement(2947989..2948201) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDENGTFYVLVNDEGQHSLWPTFADVPAGWRIVFGESSRADCLAYVEEHWTDLR PRSLRAAMAD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccatttgatgacgagaacggcaccttctacgtgctggtgaacgacgag ggccagcacagtctgtggcccacgttcgccgatgtgcccgccggctggcgcatcgtgttc ggggagtcgagccgggccgactgcctggcctacgtcgaggagcactggacggatctgcgg ccgcgcagtctgcgcgcggcgatggccgactga

DBGET integrated database retrieval system