Mycobacterium tuberculosis KZN 4207: TBSG_01608 Help Entry TBSG_01608        CDS       T01690                                  Name (GenBank) hypothetical protein mbtH   KO K05375   MbtH protein Organism mtk  Mycobacterium tuberculosis KZN 4207 Pathway mtk00261   Monobactam biosynthesis mtk01100   Metabolic pathways mtk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     TBSG_01608  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mtk01008]     TBSG_01608 Polyketide biosynthesis proteins [BR:mtk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     TBSG_01608 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEB03737 LinkDB All DBs Position 1757160..1757375 Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR PKSLRDAMAED NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system