Marivirga tractuosa: Ftrac_0094 Help Entry Ftrac_0094        CDS       T01365                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mtt  Marivirga tractuosa Pathway mtt00790   Folate biosynthesis mtt01100   Metabolic pathways mtt01240   Biosynthesis of cofactors Module mtt_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mtt00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Ftrac_0094 Enzymes [BR:mtt01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Ftrac_0094  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Ftrac_0094  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Ftrac_0094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADR20107 UniProt:  E4TVH5 LinkDB All DBs Position 113389..113754 Genome browser AA seq 121 aa AA seqDB search MKGKVALSGMAFYGYHGYYVEENKLGNHYTVDLVVETEFEQMDDSLESTLNYETLYKTTE EVMKKPLKLLETLAFHIGKKILSENESALKVLVRVNKMQPPIGALCDKAYVELEVDREDI S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaagggaaaagtagcactatccggtatggctttttatggctatcacggctattatgtg gaggagaataaactaggtaatcattatactgttgatttggttgtagaaaccgaatttgaa caaatggatgatagcctggaaagcactttaaattacgaaacgctttataaaactactgaa gaggtgatgaaaaagcctctaaaattattagaaactctagcttttcatatcggaaagaaa atcctatcagaaaatgaatctgctttaaaagtattagttcgagtgaacaaaatgcaacct cccattggggctttatgtgataaggcttatgtggagttagaggtggatagggaagatatt tcttaa

DBGET integrated database retrieval system