Micromonospora tulbaghiae: CSH63_11120 Help Entry CSH63_11120       CDS       T05651                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mtua  Micromonospora tulbaghiae Pathway mtua00261   Monobactam biosynthesis mtua01100   Metabolic pathways mtua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtua00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CSH63_11120  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mtua01008]     CSH63_11120 Polyketide biosynthesis proteins [BR:mtua01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CSH63_11120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYF27984 UniProt:  A0A386WMY2 LinkDB All DBs Position complement(2491045..2491233) Genome browser AA seq 62 aa AA seqDB search MAEPRFLVVRNDEEQYSIWSADRDLPAGWHDTGFAGSREQCLAHVDEVWTDMRPRSVREA LS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggccgaaccccgattcctggtcgtccgcaacgacgaggagcagtactcgatctggtcg gccgaccgggacctgcccgccggctggcacgacaccggcttcgccggcagccgcgagcag tgcctggcccacgtggacgaggtctggaccgacatgcgtccccgctccgtgcgcgaggca ctctcatga

DBGET integrated database retrieval system