Mycobacterium tuberculosis 7199-99: MT7199_2408 Help Entry MT7199_2408       CDS       T02617                                  Name (GenBank) PUTATIVE CONSERVED protein MBTH   KO K05375   MbtH protein Organism mtub  Mycobacterium tuberculosis 7199-99 Pathway mtub00261   Monobactam biosynthesis mtub01100   Metabolic pathways mtub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtub00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MT7199_2408  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mtub01008]     MT7199_2408 Polyketide biosynthesis proteins [BR:mtub01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MT7199_2408 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CCG12256 LinkDB All DBs Position complement(2658168..2658383) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR PKSLRDAMAED NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system