Mycobacterium tuberculosis CAS/NITR204: J113_16480 Help Entry J113_16480        CDS       T02652                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism mtuc  Mycobacterium tuberculosis CAS/NITR204 Pathway mtuc00261   Monobactam biosynthesis mtuc01100   Metabolic pathways mtuc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtuc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     J113_16480  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mtuc01008]     J113_16480 Polyketide biosynthesis proteins [BR:mtuc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     J113_16480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGL27831 UniProt:  R4MIQ9 LinkDB All DBs Position complement(2647126..2647341) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR PKSLRDAMAED NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system