Mycobacterium tuberculosis EAI5/NITR206: J114_12730 Help Entry J114_12730        CDS       T02653                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism mtue  Mycobacterium tuberculosis EAI5/NITR206 Pathway mtue00261   Monobactam biosynthesis mtue01100   Metabolic pathways mtue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtue00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     J114_12730  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mtue01008]     J114_12730 Polyketide biosynthesis proteins [BR:mtue01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     J114_12730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGL31869 LinkDB All DBs Position complement(2644902..2645117) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR PKSLRDAMAED NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system