Mycobacterium tuberculosis CCDC5079: CFBS_2516 Help Entry CFBS_2516         CDS       T02679                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism mtur  Mycobacterium tuberculosis CCDC5079 Pathway mtur00261   Monobactam biosynthesis mtur01100   Metabolic pathways mtur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtur00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CFBS_2516 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mtur01008]     CFBS_2516 (mbtH) Polyketide biosynthesis proteins [BR:mtur01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CFBS_2516 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGM00949 LinkDB All DBs Position complement(2652325..2652540) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR PKSLRDAMAED NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system