Mycobacterium tuberculosis BT2: HKBT2_2510 Help Entry HKBT2_2510        CDS       T03153                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism mtuu  Mycobacterium tuberculosis BT2 Pathway mtuu00261   Monobactam biosynthesis mtuu01100   Metabolic pathways mtuu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtuu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HKBT2_2510 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mtuu01008]     HKBT2_2510 (mbtH) Polyketide biosynthesis proteins [BR:mtuu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HKBT2_2510 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHJ47307 LinkDB All DBs Position complement(2639998..2640213) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR PKSLRDAMAED NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system