Mycobacterium tuberculosis EAI5: M943_12275 Help Entry M943_12275        CDS       T02749                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mtx  Mycobacterium tuberculosis EAI5 Pathway mtx00261   Monobactam biosynthesis mtx01100   Metabolic pathways mtx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     M943_12275  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mtx01008]     M943_12275 Polyketide biosynthesis proteins [BR:mtx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     M943_12275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGQ35666 LinkDB All DBs Position complement(2645365..2645580) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR PKSLRDAMAED NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system