Methanothermobacter wolfeii: MWSIV6_1418 Help Entry MWSIV6_1418       CDS       T04587                                  Name (GenBank) putative ferredoxin MJ0146   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mwo  Methanothermobacter wolfeii Pathway mwo00020   Citrate cycle (TCA cycle) mwo00720   Carbon fixation pathways in prokaryotes mwo01100   Metabolic pathways mwo01110   Biosynthesis of secondary metabolites mwo01120   Microbial metabolism in diverse environments mwo01200   Carbon metabolism mwo01210   2-Oxocarboxylic acid metabolism Module mwo_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mwo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MWSIV6_1418   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MWSIV6_1418 Enzymes [BR:mwo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MWSIV6_1418 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_6 Fer4_2 Fer4_7 Fer4_9 Fer4_16 Fer4_21 Fer4_8 Fer4_4 Fer4_13 Fer4_3 Fer4_17 ETF_QO Fer4_15 Fer4_18 Motif Other DBs NCBI-ProteinID:  SCM58067 LinkDB All DBs Position I:1314462..1314665 Genome browser AA seq 67 aa AA seqDB search MIRIDSELCKGCDICREFCPEGVYARSEKLNRKGVHEPVPKNLERCTKCRLCMMMCPDQA IVVYEDE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgataaggatagactcggagctctgtaagggatgtgacatatgcagagaattctgccct gaaggggtttacgcaagatcagagaagctgaaccggaagggtgtccatgaacccgtccca aaaaaccttgaaaggtgcaccaagtgcaggctatgcatgatgatgtgtccagatcaggca atagtggtgtatgaagatgagtga

DBGET integrated database retrieval system