Candidatus Mycobacterium wuenschmannii: PT015_08085 Help Entry PT015_08085       CDS       T09639                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mwu  Candidatus Mycobacterium wuenschmannii Pathway mwu00261   Monobactam biosynthesis mwu01100   Metabolic pathways mwu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mwu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PT015_08085  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mwu01008]     PT015_08085 Polyketide biosynthesis proteins [BR:mwu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PT015_08085 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WIM89389 LinkDB All DBs Position complement(1660902..1661114) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDDNGTFVVLVNDEDQHSLWPTFADVPAGWRKIFGEAGRAECLAYVEENWTDMR PRSLREAMDS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcccttcgatgacgacaacggcaccttcgtcgtgctcgtcaacgacgaa gaccagcacagcctgtggccgacgttcgccgacgttccggcgggctggcgcaagatcttc ggcgaagccggtcgcgccgaatgcctggcgtacgtcgaggagaactggaccgatatgcgg ccccggagcctccgcgaggcgatggacagctga

DBGET integrated database retrieval system