Mycobacterium sp. EPa45: AB431_02325 Help Entry AB431_02325       CDS       T03960                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism mye  Mycobacterium sp. EPa45 Pathway mye00261   Monobactam biosynthesis mye01100   Metabolic pathways mye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mye00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AB431_02325  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mye01008]     AB431_02325 Polyketide biosynthesis proteins [BR:mye01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AB431_02325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKK25732 UniProt:  A0A0G3II16 LinkDB All DBs Position 516033..516245 Genome browser AA seq 70 aa AA seqDB search MSTNPFDAEDGRFYVLVNDEEQHSLWPAFAEIPAGWQVAFGEAGRAECVEFVERSWSDMR PRSLRSATRQ NT seq 213 nt NT seq  +upstreamnt  +downstreamnt ttgagtaccaacccatttgatgccgaggacggccgcttctacgtcctggtcaacgacgag gaacagcacagcctgtggccggcgttcgccgagatcccggccggctggcaggtcgcgttc ggcgaggccggccgtgcggagtgtgtggagttcgtcgagcgaagctggtcggacatgcgg cccaggagtctgcggtcagcgactcgacagtga

DBGET integrated database retrieval system