Mycolicibacterium neoaurum NRRL B-3805: MyAD_18415 Help Entry MyAD_18415        CDS       T05013                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism myn  Mycolicibacterium neoaurum NRRL B-3805 Pathway myn00261   Monobactam biosynthesis myn01100   Metabolic pathways myn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:myn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MyAD_18415  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:myn01008]     MyAD_18415 Polyketide biosynthesis proteins [BR:myn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MyAD_18415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AMO06813 LinkDB All DBs Position complement(3931427..3931636) Genome browser AA seq 69 aa AA seqDB search MSNNPFDDEDGAFFVLINDEEQYSLWPTFADVPAGWRVVFGESTRADCLAYVEENWNDLR PKSLRDAMS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaatccattcgatgacgaggacggcgccttcttcgtgctgatcaacgacgag gagcagtacagcctctggccgacgttcgccgatgtgcccgccggctggcgggtggtgttc ggggagagcacccgcgccgactgcctggcctatgtcgaggagaactggaacgacctgcga cccaagagcctgcgcgacgccatgtcctga

DBGET integrated database retrieval system