Mycobacterium sp. VKM Ac-1817D: G155_19210 Help Entry G155_19210        CDS       T03634                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism myv  Mycobacterium sp. VKM Ac-1817D Pathway myv00261   Monobactam biosynthesis myv01100   Metabolic pathways myv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:myv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     G155_19210  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:myv01008]     G155_19210 Polyketide biosynthesis proteins [BR:myv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     G155_19210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIY47326 LinkDB All DBs Position complement(4008067..4008279) Genome browser AA seq 70 aa AA seqDB search MSSNPFDDENGTFYVLVNDEDQHSLWPSFAEVPAGWRVVFGESSRTECLTFVEQNWSDLR PRSLREAMAN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagttccaatccgttcgatgacgagaacggcacgttctacgtactggtcaacgatgag gaccagcacagcctgtggccgtcattcgccgaagtacctgccggctggcgcgtggtcttc ggtgagagcagccggacggaatgcctgacgttcgtcgagcagaactggtccgatctgcgg cccaggagtctgcgcgaggcgatggcgaactag

DBGET integrated database retrieval system