Necator americanus (New World hookworm): NECAME_18473 Help Entry NECAME_18473      CDS       T04867                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism nai  Necator americanus (New World hookworm) Pathway nai03020   RNA polymerase nai03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:nai00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     NECAME_18473   09124 Replication and repair    03420 Nucleotide excision repair     NECAME_18473  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:nai03021]     NECAME_18473    03400 DNA repair and recombination proteins [BR:nai03400]     NECAME_18473 Transcription machinery [BR:nai03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      NECAME_18473   RNA polymerase III system    RNA polymerase III      NECAME_18473   RNA polymerase I system    RNA polymerase I      NECAME_18473 DNA repair and recombination proteins [BR:nai03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       NECAME_18473 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD zinc_ribbon_13 Cytochrome_C7 A2L_zn_ribbon DUF5816 Motif Other DBs NCBI-GeneID:  25358497 NCBI-ProteinID:  XP_013295423 UniProt:  W2SWJ3 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MEGGMTPMPGGNAAGPKSTSMIYICGECHYENEIRPKDAIRCRECGYRILYKKRSRKRKF DRTEKSSSAHLFFMSIRNNLIVIIVISW NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaggtggtatgactccaatgccgggtggaaatgcggccggccctaagtcgacgagc atgatttatatttgtggagagtgtcactatgagaacgaaatccgccctaaagatgctatc cgctgccgagaatgtggatatcgtatcctttacaagaagaggagtcgtaaacgtaagttc gatagaacagaaaaatcttcttccgcacacttattcttcatgtccattagaaataatttg atagtaataatagtaatctcatggtaa

DBGET integrated database retrieval system