Necator americanus (New World hookworm): NECAME_19534 Help Entry NECAME_19534      CDS       T04867                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism nai  Necator americanus (New World hookworm) Pathway nai03020   RNA polymerase nai03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:nai00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     NECAME_19534   09124 Replication and repair    03420 Nucleotide excision repair     NECAME_19534  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:nai03021]     NECAME_19534    03400 DNA repair and recombination proteins [BR:nai03400]     NECAME_19534 Transcription machinery [BR:nai03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      NECAME_19534   RNA polymerase III system    RNA polymerase III      NECAME_19534   RNA polymerase I system    RNA polymerase I      NECAME_19534 DNA repair and recombination proteins [BR:nai03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       NECAME_19534 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD DUF5816 HypA zinc_ribbon_13 Cytochrome_C7 A2L_zn_ribbon Motif Other DBs NCBI-GeneID:  25359556 NCBI-ProteinID:  XP_013308952 UniProt:  W2TXA7 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MEGGMTPMPGGNAAGPKSTSMIYICGECHYENEIRPKDAIRCRECGYRILYKKRSRKLMV YDAR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggaaggtggtatgactccaatgccgggtggaaatgcggccgggcctaagtcgacgagc atgatttatatctgtggagagtgtcactatgagaacgaaatccgccctaaagatgctatc cgctgccgagaatgtggatatcgtatcctttacaagaagaggagtcgtaaactcatggtg tacgacgctcgataa

DBGET integrated database retrieval system