Nocardiopsis akebiae: KGD83_03460 Help Entry KGD83_03460       CDS       T08903                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism nake  Nocardiopsis akebiae Pathway nake00261   Monobactam biosynthesis nake01100   Metabolic pathways nake01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nake00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KGD83_03460  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nake01008]     KGD83_03460 Polyketide biosynthesis proteins [BR:nake01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KGD83_03460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DR2241 DUF2278 Motif Other DBs NCBI-ProteinID:  QUX29647 LinkDB All DBs Position complement(793133..793342) Genome browser AA seq 69 aa AA seqDB search MSNPFDDEDARFLVLVNDEGQHSLWPAFAEVPRGWRVAQGETSRAEALEYVEREWTDLRP ASLIAAQEG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgagcaaccccttcgacgacgaggacgcacgcttcctcgtgctggtcaacgacgagggc cagcactccctgtggcccgccttcgccgaggtgccccggggctggcgggtggcccagggc gagacctcccgggccgaggccctggagtacgtggagcgcgagtggaccgacctgcgcccg gcgagcctgatcgccgcgcaggagggctga

DBGET integrated database retrieval system