Nitrospirillum viridazoti: Y958_26315 Help Entry Y958_26315        CDS       T04935                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism nao  Nitrospirillum viridazoti Pathway nao00261   Monobactam biosynthesis nao01100   Metabolic pathways nao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nao00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Y958_26315  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nao01008]     Y958_26315 Polyketide biosynthesis proteins [BR:nao01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Y958_26315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASG24399 UniProt:  A0A248K0S5 LinkDB All DBs Position 3:complement(1049592..1049810) Genome browser AA seq 72 aa AA seqDB search MSWDSPDTRFHVVINEEEQYSIWPDHKPLPAGWQAVGVSGTRDECLAHIETVWTDMRPLS LRRALEAAGRMT NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagctgggatagccctgacacccgcttccacgtcgtgatcaacgaggaagagcaatat tccatctggccggaccacaagccgctgcctgccggctggcaggccgttggcgtcagtggc acgcgggatgagtgcctggcccacatcgagacggtgtggacggacatgcggccgttgagc ctgcgccgcgcgttggaagccgccggccggatgacctga

DBGET integrated database retrieval system