'Nostoc azollae' 0708: Aazo_0921 Help Entry Aazo_0921         CDS       T01260                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism naz  'Nostoc azollae' 0708 Pathway naz00790   Folate biosynthesis naz01100   Metabolic pathways naz01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:naz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Aazo_0921 Enzymes [BR:naz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Aazo_0921  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Aazo_0921  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Aazo_0921 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADI63323 UniProt:  D7E245 LinkDB All DBs Position 975269..975628 Genome browser AA seq 119 aa AA seqDB search MDSILLTGIRCYGYIGFLPEEQVLGQWFEIDVKLWLDLSRPGQSDNIKDTIDYRQTIRLI QNLVKTSQFALLERLTGAIADAILEDSLAITQVQVIVTKPTAPIPEFNGKISIEMTRNK NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggactcgattcttttaacaggaattcgctgttatggttacattgggtttttaccagag gaacaagttctaggacaatggtttgaaatagatgtaaagctatggttagacctttcacgt ccaggtcagtcagacaatattaaagatacgatagattatcggcaaactattagattgata caaaatctagtcaaaacctcacaatttgcattgctagaaagattaactggagctatagct gatgctattctggaggatagccttgctattacacaagtacaagttatcgtcaccaaaccc acagcacccattccggagtttaatggcaaaattagcatcgaaatgacaagaaataagtaa

DBGET integrated database retrieval system