Nocardioidaceae bacterium TYQ2: KLP28_09005 Help Entry KLP28_09005       CDS       T08881                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nbt  Nocardioidaceae bacterium TYQ2 Pathway nbt00790   Folate biosynthesis nbt01100   Metabolic pathways nbt01240   Biosynthesis of cofactors Module nbt_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:nbt00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     KLP28_09005 (folB) Enzymes [BR:nbt01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      KLP28_09005 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      KLP28_09005 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      KLP28_09005 (folB) BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QWC83779 UniProt:  A0A975MDY7 LinkDB All DBs Position 1891039..1891422 Genome browser AA seq 127 aa AA seqDB search MRDPQTDLDELTVRGIEVFAHHGVLESERREGQTFRVDLTLGLGTSLAAQTDRLEDTVDY GALVGEVVAAVERDPVDLIETVAQRVAEVCLTDPRVQRVVVSLHKPHAPIDATFDDVVLT ITRSRSD NT seq 384 nt NT seq  +upstreamnt  +downstreamnt gtgcgcgacccgcagaccgacctcgacgagctcaccgtgcgtggcatcgaggtcttcgcc caccacggcgtgctcgagtccgagcgccgcgaggggcagacgttccgcgtcgacctgacg ctcggactcggcacgagcctggcggcccagaccgaccgcctggaggacaccgtggactac ggcgccctggtcggggaggtcgtggcggcggtggagcgcgacccggtcgacctgatcgag acggtcgcccagcgtgttgccgaggtctgcttgactgacccacgcgtgcagcgtgtggtg gtctccctccacaaaccccacgcaccgatcgatgcgacgttcgacgacgtcgtcctcacc atcacccggagccgcagtgactga

DBGET integrated database retrieval system