Notothenia coriiceps (black rockcod): 104954787 Help Entry 104954787         CDS       T04920                                  Name (RefSeq) GTP cyclohydrolase 1-like   KO K01495   GTP cyclohydrolase IA [EC:3.5.4.16] Organism ncc  Notothenia coriiceps (black rockcod) Pathway ncc00790   Folate biosynthesis ncc01100   Metabolic pathways ncc01240   Biosynthesis of cofactors Module ncc_M00842   Tetrahydrobiopterin biosynthesis, GTP => BH4 Brite KEGG Orthology (KO) [BR:ncc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104954787 Enzymes [BR:ncc01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.4  In cyclic amidines     3.5.4.16  GTP cyclohydrolase I      104954787 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GTP_cyclohydroI QueF Motif Other DBs NCBI-GeneID:  104954787 NCBI-ProteinID:  XP_010780281 UniProt:  A0A6I9P172 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search SHCWQVHIGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPTGVGVVI EATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTRDEFLTLIRS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt tcccactgttggcaggttcacatcggttaccttcccaacaagagagttctgggcctcagt aagctggccaggattgttgaaatctacagccgtcgactacaagttcaggagaggttgacc aaacagatagccgtggcgatcacagaggccctgcagcctaccggggtgggggtggtcatc gaggcaactcacatgtgtatggtgatgcgaggcgttcagaagatgaacagtaaaaccgtc accagcaccatgttgggagtcttcagggaagatccgaaaacccgtgatgagtttctgacg ctgatcaggagctga

DBGET integrated database retrieval system