Natranaerofaba carboxydovora: ACONDI_01038 Help Entry ACONDI_01038      CDS       T07970                                  Name (GenBank) 4Fe-4S dicluster domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ncd  Natranaerofaba carboxydovora Pathway ncd00020   Citrate cycle (TCA cycle) ncd01100   Metabolic pathways ncd01110   Biosynthesis of secondary metabolites ncd01120   Microbial metabolism in diverse environments ncd01200   Carbon metabolism ncd01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ncd00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ACONDI_01038 Enzymes [BR:ncd01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ACONDI_01038 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_9 Fer4_10 Fer4_16 Fer4_4 Fer4_2 Fer4_21 Fer4_8 Fer4_17 Fer4_3 Fer4_6 Fer4_15 Fer4_22 Fer4_13 ETF_QO Motif Other DBs NCBI-ProteinID:  UMZ73484 LinkDB All DBs Position 1072867..1073085 Genome browser AA seq 72 aa AA seqDB search MVDAKKSPVSVAGKWCKGCGICIEFCPKKVLDFDSKGKSYVKNPEDCNKCQQCELRCPDF AIVVKKGEKDNE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggtagatgctaaaaaatcaccagtctctgttgcaggcaaatggtgcaaaggctgtgga atatgcatagaattttgtcccaagaaagtattagactttgattccaagggtaaatcttat gtcaaaaacccagaggattgtaataaatgtcaacaatgtgaacttcgctgcccggatttt gcgattgttgtaaaaaagggggagaaagataatgagtga

DBGET integrated database retrieval system