Neisseria canis: NCTC10296_01928 Help Entry NCTC10296_01928   CDS       T06799                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nci  Neisseria canis Pathway nci00790   Folate biosynthesis nci01100   Metabolic pathways nci01240   Biosynthesis of cofactors Module nci_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:nci00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     NCTC10296_01928 (folB) Enzymes [BR:nci01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      NCTC10296_01928 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      NCTC10296_01928 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      NCTC10296_01928 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB KinB_sensor Motif Other DBs NCBI-ProteinID:  VEF02699 UniProt:  A0A448DAD0 LinkDB All DBs Position 1:2010820..2011170 Genome browser AA seq 116 aa AA seqDB search MDKIFLHGMKAETLIGVYAWEREQKQTLLLDIDIGVPPQSAASDDIADTIHYADVCQAIR QSLGHQNFMLLEALAEHVAELVLQDFGALWVRVRVVKPGILEGVRETGVEIERSAL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggataaaatctttttgcacggtatgaaagctgaaacgctcatcggcgtgtacgcttgg gagcgcgagcaaaaacaaactctgctgctggacatagacatcggcgtgccgccgcaatcc gcagcttccgacgatatagccgacaccatacattatgccgacgtatgccaagccatccgc caaagtttgggccatcagaatttcatgctgctcgaagctttagctgaacatgtggcggag ctggttttgcaagatttcggcgcattatgggtgcgcgtccgtgtcgttaagcccggcata ttggaaggagtaagggaaaccggtgtagaaatagaacgctcggccttataa

DBGET integrated database retrieval system