Neurospora crassa: NCU11012 Help Entry NCU11012          CDS       T01034                                  Name (RefSeq) DNA-directed RNA polymerase I   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism ncr  Neurospora crassa Pathway ncr03020   RNA polymerase ncr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ncr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     NCU11012   09124 Replication and repair    03420 Nucleotide excision repair     NCU11012  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ncr03021]     NCU11012    03400 DNA repair and recombination proteins [BR:ncr03400]     NCU11012 Transcription machinery [BR:ncr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      NCU11012   RNA polymerase III system    RNA polymerase III      NCU11012   RNA polymerase I system    RNA polymerase I      NCU11012 DNA repair and recombination proteins [BR:ncr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       NCU11012 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Pox_RNA_Pol_19 Motif Other DBs NCBI-GeneID:  5847863 NCBI-ProteinID:  XP_001728485 UniProt:  A7UVS4 LinkDB All DBs Position III:2367170..2368718 Genome browser AA seq 160 aa AA seqDB search MSDYGDHGDDDREPIDEPAFDEDPDEYYEPEPEPADDDVAGRPGDEVDEAENDNNIVTSG DPNAAANAGKGNEKSHKDKKIPNDQRSTTPYMTKYEKARILGTRALQISMNAPVLVDLEG ETDPLQIAIKELREKKIPLIVRRYMPDGYYEDWTCEELLQ NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtccgactacggtgaccacggtgacgatgatcgcgagcctatcgacgagcccgccttc gatgaggacccggatgagtactacgagcccgaacccgagcccgcggacgacgacgtagcg ggcagacccggcgacgaagtcgacgaggccgaaaacgataacaacatagtcacttcgggt gaccctaacgcggccgccaacgctggcaagggcaacgagaaatcccacaaggacaagaag attcccaacgaccagcgttccacgacaccttacatgaccaagtacgagaaagctcgtatc ctcggcacacgtgctctgcaaatcagcatgaacgcgccagtgctggttgatctcgagggt gagacggatcctcttcaaatcgccatcaaggagctgcgcgagaagaagattcctctgatt gtccgtcgttacatgcctgatggatactacgaggactggacctgcgaggagctcctgcag taa

DBGET integrated database retrieval system