Nonomuraea coxensis: Nocox_13370 Help Entry Nocox_13370       CDS       T07466                                  Symbol noc19 Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism ncx  Nonomuraea coxensis Pathway ncx00261   Monobactam biosynthesis ncx01100   Metabolic pathways ncx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ncx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Nocox_13370 (noc19)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ncx01008]     Nocox_13370 (noc19) Polyketide biosynthesis proteins [BR:ncx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Nocox_13370 (noc19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QYC40291 LinkDB All DBs Position 2877765..2877974 Genome browser AA seq 69 aa AA seqDB search MTNPFDNEDGSFLVLVNDEGQHSLWPAFAEVPLGWTRVHGEATRQECLAYVEENWTDIRP KSLIAEAGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgacaacgaagacggttccttcctcgtgctcgtcaacgacgaaggg cagcactcgctctggcccgcgttcgcggaggtgccgctcggctggacccgcgtccacggc gaggccacccgccaggaatgcctcgcctacgtcgaggagaactggacggacatccggccg aagagcctcatcgcggaggcgggcgcctga

DBGET integrated database retrieval system