Nonomuraea coxensis: Nocox_20050 Help Entry Nocox_20050       CDS       T07466                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism ncx  Nonomuraea coxensis Pathway ncx00261   Monobactam biosynthesis ncx01100   Metabolic pathways ncx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ncx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Nocox_20050  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ncx01008]     Nocox_20050 Polyketide biosynthesis proteins [BR:ncx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Nocox_20050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QYC41619 LinkDB All DBs Position complement(4309035..4309226) Genome browser AA seq 63 aa AA seqDB search MADGTYKVVVNDEEQYSIWFADRPLPAGWREEGFSGAKQDCLDHVERVWTDMRPRSLREA MGQ NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggcggacggcacgtacaaggtcgtggtcaacgacgaggagcagtactccatctggttc gccgaccgtcccctgccggcgggctggcgggaggaaggcttctcgggggcgaagcaggac tgcctcgaccacgtcgaacgggtctggaccgacatgcgcccgcgcagcctgcgcgaggcc atggggcagtag

DBGET integrated database retrieval system