Nocardiopsis eucommiae: KGD82_02330 Help Entry KGD82_02330       CDS       T08767                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism nec  Nocardiopsis eucommiae Pathway nec00261   Monobactam biosynthesis nec01100   Metabolic pathways nec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nec00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KGD82_02330  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nec01008]     KGD82_02330 Polyketide biosynthesis proteins [BR:nec01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KGD82_02330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QVJ01858 UniProt:  A0A975LAX8 LinkDB All DBs Position 497755..497964 Genome browser AA seq 69 aa AA seqDB search MQNPFDDTDASFLVLVNAEDQHSLWPAFVPVPAGWVVRHGPAERQECLTYIDTHWTDMRP HRVRQLDAA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcagaacccgttcgacgacaccgacgcctccttcctggtcctggtcaacgccgaggac cagcactccctgtggcccgccttcgtcccggtccccgccggctgggtcgtgcgccacggc cccgccgagcgccaggagtgcctgacctacatcgacacccactggacggacatgcgaccc caccgggtccgccagctcgacgccgcctga

DBGET integrated database retrieval system