Nocardia farcinica IFM 10152: NFA_5500 Help Entry NFA_5500          CDS       T00207                                  Name (GenBank) putative MbtH family protein   KO K05375   MbtH protein Organism nfa  Nocardia farcinica IFM 10152 Pathway nfa00261   Monobactam biosynthesis nfa01100   Metabolic pathways nfa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nfa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NFA_5500  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nfa01008]     NFA_5500 Polyketide biosynthesis proteins [BR:nfa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NFA_5500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAD55395 NIH_Japan:  nfa5500 UniProt:  Q5Z2E6 LinkDB All DBs Position 566859..567101 Genome browser AA seq 80 aa AA seqDB search MSTNPFDDEDGRFFVLVNDEEQHSLWPAFAEVPAGWRVVFGEDSRAACVEYVEKNWTDMR PKSLRDAMAADDAARQGAQS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacgaagacggccggttcttcgtcctggtcaacgacgag gaacagcactccctgtggcccgccttcgcggaggttccggccggatggcgagtggtgttc ggtgaggacagccgcgccgcgtgcgtggagtacgtcgagaagaactggaccgacatgcgt cccaagagcctgcgcgacgcgatggccgccgacgacgcggcccggcagggcgcccagtcc tga

DBGET integrated database retrieval system