Nonomuraea gerenzanensis: LCN96_24930 Help Entry LCN96_24930       CDS       T07782                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ngn  Nonomuraea gerenzanensis Pathway ngn00261   Monobactam biosynthesis ngn01100   Metabolic pathways ngn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ngn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LCN96_24930  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ngn01008]     LCN96_24930 Polyketide biosynthesis proteins [BR:ngn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LCN96_24930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UBU18150 LinkDB All DBs Position 5318928..5319122 Genome browser AA seq 64 aa AA seqDB search MNPFDDPDGEFFVLANDEEQHSIWPSFAAVPEGWSVRFGPDSRAACLAYVSASWTDLRPR SLRR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaaccccttcgacgaccccgacggcgagttcttcgtcctggccaacgacgaggagcag cactccatctggccctccttcgccgccgtgcccgagggctggtcggtgcgcttcggcccc gactcccgcgccgcgtgcctggcctacgtctccgcctcctggaccgacctgcgtccccgc agcctgcgtcggtga

DBGET integrated database retrieval system