Naegleria gruberi: NAEGRDRAFT_33993 Help Entry NAEGRDRAFT_33993  CDS       T01241                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism ngr  Naegleria gruberi Pathway ngr03020   RNA polymerase ngr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ngr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     NAEGRDRAFT_33993   09124 Replication and repair    03420 Nucleotide excision repair     NAEGRDRAFT_33993  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ngr03021]     NAEGRDRAFT_33993    03400 DNA repair and recombination proteins [BR:ngr03400]     NAEGRDRAFT_33993 Transcription machinery [BR:ngr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      NAEGRDRAFT_33993   RNA polymerase III system    RNA polymerase III      NAEGRDRAFT_33993   RNA polymerase I system    RNA polymerase I      NAEGRDRAFT_33993 DNA repair and recombination proteins [BR:ngr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       NAEGRDRAFT_33993 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  8856624 NCBI-ProteinID:  XP_002676556 JGI:  Naegr1_33993 LinkDB All DBs AA seq 130 aa AA seqDB search EQFEGDDNVEDEYQQGEDESEILPEDDVMLEETDDVDAPYLPVDKNKVPKEDRKTTRKMT KFEKARVLGTRALQISMNAPVTVELQGETDPLQIAKKELQQKKIPMIIRRYLPDKSYEDW HVNELEIDFE NT seq 393 nt NT seq  +upstreamnt  +downstreamnt gaacaatttgaaggtgatgacaatgttgaagatgaatatcaacaaggagaagatgaatca gaaattcttccagaagatgatgtcatgttagaagaaactgatgatgttgatgctccatat ttgccagttgataaaaacaaagttccaaaggaagacagaaaaaccactagaaagatgact aaattcgaaaaggctagagttttgggaacaagagctcttcaaatttctatgaatgctcct gttactgtagaattacaaggtgaaacagatccactccaaattgctaagaaggaacttcaa caaaagaagattccaatgatcattagaagatacttgccagataaatcatatgaagattgg catgtgaatgaactcgaaattgactttgaataa

DBGET integrated database retrieval system