Fusarium vanettenii: NECHADRAFT_79417 Help Entry NECHADRAFT_79417  CDS       T01612                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism nhe  Fusarium vanettenii Pathway nhe03020   RNA polymerase nhe03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:nhe00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     NECHADRAFT_79417   09124 Replication and repair    03420 Nucleotide excision repair     NECHADRAFT_79417  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:nhe03021]     NECHADRAFT_79417    03400 DNA repair and recombination proteins [BR:nhe03400]     NECHADRAFT_79417 Transcription machinery [BR:nhe03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      NECHADRAFT_79417   RNA polymerase III system    RNA polymerase III      NECHADRAFT_79417   RNA polymerase I system    RNA polymerase I      NECHADRAFT_79417 DNA repair and recombination proteins [BR:nhe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       NECHADRAFT_79417 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  9670866 NCBI-ProteinID:  XP_003051885 JGI:  79417 UniProt:  C7YNT4 LinkDB All DBs Position 4 AA seq 161 aa AA seqDB search MSDFGDDDVGGAGGDEPMYEDEEVTEYYDPEVVEEDEDGENRPQDGEDMDNVVVSGDPSA AANALKGGEKLLKDKKIPEGERTTTPYMTKYERARILGTRALQIRFAFLERDASRPGWLT GETDPLQIAIKEMREKKIPLIVRRYLPDGYYEDWTCEELLQ NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtctgactttggtgatgatgatgttggtggcgctggcggtgacgagcccatgtacgag gacgaggaggttaccgagtactacgaccccgaggttgtcgaagaggatgaggatggtgag aaccgacctcaagatggcgaggatatggacaatgttgttgtttctggcgacccttctgct gctgcgaacgcgctcaagggcggcgagaagctgctcaaagacaagaagatccccgagggc gagcgaaccacgacgccttacatgaccaagtacgagagggcgcgcatcctcggaacccgc gccctgcagatcaggtttgcattcctcgagcgcgacgcatcgcgacccggatggctaact ggcgagacggaccccctgcagattgccatcaaggagatgcgggagaagaagatccccttg atcgtgcgacgataccttccggacggatactacgaggactggacctgcgaggaactgctg cagtga

DBGET integrated database retrieval system